PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462933452
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family TALE
Protein Properties Length: 282aa    MW: 31211.2 Da    PI: 5.1356
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462933452genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.8e-092142472255
                SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 +yp++e++ +LA+ +gL+ +q+ +WF N+R ++
  462933452 214 WPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRH 247
                59*****************************885 PP

2ELK33.31.1e-11167188122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK++Ll+KYsg+L+ L++EF+
  462933452 167 ELKEMLLKKYSGCLSRLRSEFL 188
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.9E-192973IPR005540KNOX1
PfamPF037902.0E-203170IPR005540KNOX1
SMARTSM012561.5E-2577128IPR005541KNOX2
PfamPF037911.7E-2281127IPR005541KNOX2
PROSITE profilePS5121310.423167187IPR005539ELK domain
PfamPF037891.3E-8167188IPR005539ELK domain
SMARTSM011883.6E-6167188IPR005539ELK domain
PROSITE profilePS5007112.681187250IPR001356Homeobox domain
SMARTSM003892.5E-14189254IPR001356Homeobox domain
SuperFamilySSF466896.42E-20189259IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-27192252IPR009057Homeodomain-like
CDDcd000862.37E-13199251No hitNo description
PfamPF059204.5E-17207246IPR008422Homeobox KN domain
PROSITE patternPS000270225248IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MEDLYSIHPG ISRAGATSEA PPPPADLTEL VKAQIAGHPR YPTLLSAYIE CRKVGAPPEV  60
AALLEEIGRE RCAAASAAGE VGLDPELDEF MDAYCRVLER YKEELTRPFD EAASFLSSVR  120
TQLTSLCGGA ASLSDEMVGS SEDEPCSGDT DATDLGQEHS SRLADRELKE MLLKKYSGCL  180
SRLRSEFLKK RKKGKLPKDA RSALMDWWNT HYRWPYPTEE DKVRLAAMTG LDPKQINNWF  240
INQRKRHWKP SEDMRFALME GVTGGGSSSG TTLYFDTGTI GP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182191LRSEFLKKRK
2188192KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105084.11e-175liguleless 4
SwissprotQ9FP291e-152KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A0A9BTH01e-178A0A0A9BTH0_ARUDO; Uncharacterized protein
STRINGGRMZM2G094241_P011e-174(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.12e-83KNOTTED1-like homeobox gene 6